Github Top Repositories

Open in Telegram

Top GitHub repositories in one place 🚀 Explore the best projects in programming, AI, data science, and more.

📈 Analytical overview of Telegram channel Github Top Repositories

Channel Github Top Repositories (@githubre) in the English language segment is an active participant. Currently, the community unites 13 260 subscribers, ranking 15 384 in the Education category and 32 523 in the India region.

📊 Audience metrics and dynamics

Since its creation on невідомо, the project has demonstrated rapid growth, gathering an audience of 13 260 subscribers.

According to the latest data from 09 June, 2026, the channel demonstrates stable activity. Although there has been a change in the number of participants by 373 over the last 30 days and by 13 over the last 24 hours, overall reach remains high.

Verification status: Not verified
Engagement rate (ER): The average audience engagement rate is 1.17%. Within the first 24 hours after publication, content typically collects 0.73% reactions from the total number of subscribers.
Post reach: On average, each post receives 155 views. Within the first day, a publication typically gains 97 views.
Reactions and interaction: The audience actively supports content: the average number of reactions per post is 1.
Thematic interests: Content is focused on key topics such as repository, fork, programming, statistic, description.

📝 Description and content policy

The author describes the resource as a platform for expressing subjective opinions:
“Top GitHub repositories in one place 🚀 Explore the best projects in programming, AI, data science, and more.”

Thanks to the high frequency of updates (latest data received on 10 June, 2026), the channel maintains relevance and a high level of publication reach. Analytics show that the audience actively interacts with content, making it an important point of influence in the Education category.

13 260

Subscribers

+1324 hours

+737 days

+37330 days

155

Post views

~ 9724 hours

~ 11048 hours

1.17%

Engagement rate

~ 41

Posts per day

Ads index

beta

Posts Archive

13 260

🔥 harry0703/MoneyPrinterTurbo is trending — and it deserves your attention. 🔗 https://github.com/harry0703/MoneyPrinterTurbo 📝 利用AI大模型，一键生成高清短视频 Generate short videos with one click using AI LLM. ────────────────────────────── MoneyPrinterTurbo is an open-source project that allows users to generate high-definition videos with customizable themes, music, and subtitles. The project uses a Model-View-Controller (MVC) architecture and supports both API and Web interface interactions. To use MoneyPrinterTurbo, users can provide a video theme or keyword, and the system will automatically generate a video script, video materials, subtitles, and background music. The project supports various video sizes, including 9:16 and 16:9, and allows for batch video generation. The project has several technical highlights, including support for AI-generated video scripts, multi-language subtitles, and background music. It also supports various LLM providers, such as OpenAI and Azure. MoneyPrinterTurbo is suitable for users who want to generate high-quality videos quickly and easily. The project is open-source and has a permissive license, making it accessible to a wide range of users. To get started with MoneyPrinterTurbo, users can follow the quick start guide in the project's README file. The guide provides step-by-step instructions for installing the project, configuring the environment, and generating videos. In summary, MoneyPrinterTurbo is a powerful tool for generating high-quality videos with customizable themes, music, and subtitles. With its open-source nature and permissive license, it is an excellent choice for users who want to create engaging videos quickly and easily. Automate your video creation with MoneyPrinterTurbo - no video editing experience required! ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

⚡ codecrafters-io/build-your-own-x is making waves. Here's the full picture. 🔗 https://github.com/codecrafters-io/build-your-own-x 📝 Master programming by recreating your favorite technologies from scratch. ────────────────────────────── The codecrafters-io/build-your-own-x GitHub repository is a collection of step-by-step guides for building various technologies from scratch. It covers a wide range of topics, including 3D renderers, AI models, blockchains, bots, databases, and more. The repository provides tutorials and examples in different programming languages, such as C++, Java, Python, and JavaScript. Whether you're a beginner or an experienced developer, this repository offers a valuable resource for learning and exploring new technologies. The guides are designed to be practical and hands-on, allowing you to build and experiment with your own projects. So, what I cannot create, I do not understand - start building and learning with codecrafters-io/build-your-own-x today! Build something from scratch, and you'll never see it the same way again. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🌟 DataTalksClub/data-engineering-zoomcamp caught my eye on GitHub Trending today. 🔗 https://github.com/DataTalksClub/data-engineering-zoomcamp 📝 Data Engineering Zoomcamp is a free 9-week course on building production-ready data pipelines. The next cohort starts in January 2026. Join the course here 👇🏼 ────────────────────────────── The Data Engineering Zoomcamp is a free 9-week course that covers the fundamentals of data engineering. It's designed to help you build an end-to-end data pipeline from scratch, with hands-on experience using industry-standard tools and best practices. Key features of the course include structured modules, hands-on workshops, and a final project to reinforce your learning. You'll learn about containerization, infrastructure as code, workflow orchestration, data warehousing, and analytics engineering. The course is suitable for anyone with basic coding experience and familiarity with SQL. No prior data engineering experience is necessary. You can enroll in the course by registering for the next cohort or following the self-paced learning path. The course has a strong community and support system, with a dedicated #course-data-engineering channel on Slack for discussions and troubleshooting. The course is taught by experienced instructors, including Alexey Grigorev and Michael Shoemaker, and is sponsored by companies like Kestra and Bruin. Overall, the Data Engineering Zoomcamp is a great resource for anyone looking to learn data engineering fundamentals and build a career in the field. So, what are you waiting for? Join the course and start building your skills today - it's a free 9-week course that can change your career! ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🔥 I send Gold alerts. You copy. No experience. No complex charts. 10 minutes/day from your phone. Join Tania’s Free Academy 👇 #ad 📢 InsideAd

13 260

🌟 hardikpandya/stop-slop caught my eye on GitHub Trending today. 🔗 https://github.com/hardikpandya/stop-slop 📝 A skill file for removing AI tells from prose ────────────────────────────── The Stop Slop GitHub repository is a skill designed to remove AI tells from prose, making your writing sound more human. The key features include a set of rules and references that help catch and remove predictable phrases, structures, and rhythms. To use it, simply add the folder as a skill or upload the SKILL.md and reference files to your project knowledge. You can also include SKILL.md in your system prompt for API calls. The repository catches various patterns such as banned phrases, structural clichés, and sentence-level rules, and even provides a scoring system to rate your writing. This repository is perfect for writers and developers looking to improve their writing skills and make their content sound more authentic. In a nutshell, Stop Slop helps you write like a human, not a robot - so stop the slop and start writing. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

💡 affaan-m/ECC just hit the trending charts — here's why it matters. 🔗 https://github.com/affaan-m/ECC 📝 The agent harness performance optimization system. Skills, instincts, memory, security, and research-first development for Claude Code, Codex, Opencode, Cursor and beyond. ────────────────────────────── ECC is an open-source, harness-native operator system for agentic work, built from real-world multi-harness engineering workflows. It's designed to work across various AI agent harnesses, including Codex, Claude Code, Cursor, OpenCode, and more. The system provides a complete set of features, including skills, instincts, memory optimization, continuous learning, security scanning, and research-first development. To get started with ECC, you can follow the HERMES setup guide and review the release notes and cross-harness architecture documentation. Key features include: - Token optimization - Memory persistence - Continuous learning - Verification loops - Parallelization - Subagent orchestration ECC is suitable for developers, engineers, and researchers working with AI agent harnesses. Technical highlights include support for multiple programming languages, such as Python, Java, Go, and TypeScript. In summary, ECC is a powerful tool for building and managing AI agent workflows, and its open-source nature makes it a great choice for anyone looking to automate and optimize their workflows - ECC is the future of agentic work, and the future is now. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🌟 DigitalPlatDev/FreeDomain caught my eye on GitHub Trending today. 🔗 https://github.com/DigitalPlatDev/FreeDomain 📝 DigitalPlat FreeDomain: Free Domain For Everyone ────────────────────────────── DigitalPlat FreeDomain is a platform that offers free domain names to individuals and organizations, promoting a more accessible web. The goal is to make the internet an open space where everyone can have their own online presence, regardless of budget. Key features include free domain registration with various extensions like .DPDNS.ORG and .US.KG, and the freedom to host with your preferred DNS provider. To get started, simply visit the DigitalPlat FreeDomain Dashboard and follow the tutorial. From a technical standpoint, the project has grown significantly, now supporting over 500,000 domains. The founder, Edward Hsing, shares the story of how this started as a small DNS experiment and evolved into a reliable service. The target audience is anyone looking to establish an online presence without the burden of domain costs. Whether you're a developer, blogger, or just starting out, DigitalPlat FreeDomain is a great option. In short, DigitalPlat FreeDomain is a game-changer for those who want to create a website without breaking the bank - Claim your free domain and start building your online presence today! ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

💡 Crosstalk-Solutions/project-nomad just hit the trending charts — here's why it matters. 🔗 https://github.com/Crosstalk-Solutions/project-nomad 📝 Project N.O.M.A.D, is a self-contained, offline survival computer packed with critical tools, knowledge, and AI to keep you informed and empowered—anytime, anywhere. ────────────────────────────── Project N.O.M.A.D. is a self-contained, offline-first knowledge and education server that empowers users with critical tools and AI, anytime, anywhere. Key features include an AI chat with knowledge base, information library, education platform, offline maps, data tools, and notes. To get started, users can follow the Quick Install guide for Debian-based operating systems. For more control, advanced users can use the Docker Compose template to customize their installation. Technical highlights of Project N.O.M.A.D. include its management UI and API, which orchestrate a collection of containerized tools and resources via Docker. The project is suitable for users who want to access knowledge and education resources offline, including students, researchers, and individuals in areas with limited internet connectivity. The project is licensed under the Apache License 2.0 and has a growing community with resources like a website, Discord channel, and benchmark leaderboard. In a nutshell, Project N.O.M.A.D. is the ultimate offline companion for knowledge seekers - empowering minds, anywhere. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🎯 Biohub/esm landed on trending. Worth a proper look. 🔗 https://github.com/Biohub/esm 📝 No description. ────────────────────────────── The Biohub/esm GitHub repository presents a groundbreaking world model of protein biology, leveraging the latest advancements in Evolutionary Scale Modeling (ESM). This comprehensive system comprises three primary components: ESMC, ESMFold2, and ESM Atlas. ESMC is a state-of-the-art protein language model trained on billions of protein sequences, allowing it to learn and represent the rules of protein biology. ESMFold2 builds upon ESMC and is a state-of-the-art structure prediction model that can predict high-resolution, all-atom 3D protein structures directly from amino acid sequences. The ESM Atlas is a vast map of 6.8 billion proteins, organized according to the internal world model of ESMC, enabling the prediction of over one billion structures. These tools can be utilized through the Biohub Platform or by running the models locally with Hugging Face. The repository provides extensive documentation, including tutorials and preprints, to facilitate understanding and usage. The target audience includes researchers, scientists, and developers interested in protein biology, structure prediction, and world modeling. Here is a simple example of running ESMC locally:

import torch
from transformers import AutoModelForMaskedLM, AutoTokenizer

# example GFP sequence
sequences = ["MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK"]

model = AutoModelForMaskedLM.from_pretrained(
    "Biohub/ESMC-6B",
    device_map="auto",
).eval()
tokenizer = AutoTokenizer.from_pretrained("Biohub/ESMC-6B")

inputs = tokenizer(sequences, return_tensors="pt", padding=True)
inputs = {k: v.to(model.device) for k, v in inputs.items()}
with torch.inference_mode():
    output = model(**inputs)

To get started, simply install the esm library and import the necessary modules. With Biohub/esm, unlock the power of world modeling in protein biology and discover new frontiers in protein structure prediction and design. The future of protein biology is here, and it's being modeled with unprecedented accuracy. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🎯 byoungd/English-level-up-tips landed on trending. Worth a proper look. 🔗 https://github.com/byoungd/English-level-up-tips 📝 An advanced guide to learn English which might benefit you a lot 🎉 . 离谱的英语学习指南/英语学习教程/英语学习/学英语 ────────────────────────────── The English-level-up-tips GitHub repository is a comprehensive guide to learning English, dedicated to the author's past love, W. This project aims to provide a detailed and advanced guide to help individuals improve their English skills. The guide covers various aspects of the English language, including understanding, vocabulary, listening, reading, speaking, and writing. It also features a chapter on AI and its application in language learning. The guide is suitable for anyone looking to improve their English skills, from beginners to advanced learners. It's a valuable resource for those who want to learn English in a natural and enjoyable way. Key features of the guide include its comprehensive coverage of the English language, its use of AI in language learning, and its focus on making learning English a fun and rewarding experience. The guide is available for online reading on various platforms, including GitHub Pages, GitBook, and Zhihu. In short, the English-level-up-tips guide is a must-have resource for anyone looking to improve their English skills, and with dedication and practice, you can master the English language and unlock a world of new opportunities. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🚀 Meet galilai-group/stable-worldmodel: a gem from today's GitHub trending list. 🔗 https://github.com/galilai-group/stable-worldmodel 📝 A platform for reproducible world model research and evaluation ────────────────────────────── The stable-worldmodel repository provides a unified platform for world model research and evaluation. It offers a single interface for data collection, training, and evaluation with model-predictive control across various environments. The repository includes reference implementations of common baselines and planning solvers, allowing researchers to focus on their core contributions. The library supports multiple data formats, including lance, hdf5, folder, video, and lerobot, and provides tools for format conversion and benchmarking. It also features a large suite of environments, including those from the DeepMind Control Suite, Gymnasium, and OGBench, with factors of variation for evaluating zero-shot generalization. To get started, users can install the library via PyPI and follow the quick start guide to collect data, train a world model, and evaluate it using model-predictive control. The repository is in active development, with APIs subject to change between minor versions. The stable-worldmodel library is designed for researchers and developers working on world models, and its unified interface and reference implementations make it an ideal choice for those looking to advance the state-of-the-art in this field. With stable-worldmodel, the world is your model, and the possibilities are endless. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

📌 Spotted on GitHub Trending: run-llama/liteparse — let's break it down. 🔗 https://github.com/run-llama/liteparse 📝 A fast, helpful, and open-source document parser ────────────────────────────── LiteParse is a fast and lightweight, open-source PDF parsing tool that delivers high-quality spatial text parsing with bounding boxes. It runs locally on your machine, without relying on proprietary features or cloud dependencies. Key features of LiteParse include fast text parsing using PDFium, a flexible OCR system with built-in Tesseract and support for HTTP servers, screenshot generation, and multiple output formats like JSON and text. It also supports multi-language use from Rust, Node.js/TypeScript, Python, or the browser (WASM) and is multi-platform, compatible with Linux, macOS, and Windows. To install LiteParse, you can use your preferred package manager. For example, you can install it via npm for Node.js/TypeScript, pip for Python, or cargo for Rust. The CLI usage is straightforward. You can parse files using the lit parse command, generate screenshots with lit screenshot, and perform batch parsing with lit batch-parse. Technical highlights include automatic conversion of various document formats to PDF before parsing, support for office documents via LibreOffice, and image formats via ImageMagick. Audience: LiteParse is suitable for developers and users who need fast and accurate PDF parsing capabilities, especially those working with large volumes of documents or requiring precise text positioning information. In summary, LiteParse is a powerful, user-friendly tool that provides fast and accurate PDF parsing, making it an excellent choice for anyone looking to extract valuable information from their documents - Parse your documents, unleash the power of your data. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

🌟 cursor/plugins caught my eye on GitHub Trending today. 🔗 https://github.com/cursor/plugins 📝 Cursor plugin specification and official plugins ────────────────────────────── The Cursor plugins repository offers a collection of official plugins for various developer tools, frameworks, and SaaS products. Each plugin is a standalone directory with its own manifest, making it easy to manage and maintain. Key features include continual learning for incremental memory updates, thermos for deep security audits, and create-plugin for scaffolding new plugins. To use these plugins, simply navigate to the desired plugin directory and follow the instructions in the README.md file. From a technical standpoint, the repository uses a marketplace.json file to list all available plugins, and each plugin has its own plugin.json manifest. These plugins are perfect for developers and dev teams looking to streamline their workflow and improve productivity. In short, the Cursor plugins repository is a game-changer for development teams - it's like having a superpower in your coding toolkit. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe

13 260

📌 Spotted on GitHub Trending: Leonxlnx/taste-skill — let's break it down. 🔗 https://github.com/Leonxlnx/taste-skill 📝 Taste-Skill - gives your AI good taste. stops the AI from generating boring, generic slop ────────────────────────────── Taste Skill is an innovative GitHub repository designed to enhance the capabilities of AI agents in building premium frontends. The repo offers a range of portable agent skills that focus on improving layout, typography, motion, and spacing, resulting in more sophisticated and polished UIs. Key features include adjustable dials for design variance, motion intensity, and visual density, allowing for customized outputs. The skills are framework-agnostic and compatible with major coding agents like Codex, Cursor, and Claude Code. To get started, simply install the desired skill using npx skills add https://github.com/Leonxlnx/taste-skill, then use the installed skill in your agent conversations. For image-generation skills, pair them with ChatGPT Images or similar generators to produce design images. The repo is suitable for developers and designers looking to elevate their frontend builds with AI-driven design skills. With its unique approach to anti-slop design and extensive research backing, Taste Skill is a valuable tool for anyone seeking to create high-end interfaces. In a nutshell, Taste Skill is a game-changer for AI-powered frontend development - revolutionizing the way we design and build premium UIs, one skill at a time. ────────────────────────────── 🧠 Channel: https://t.me/GithubRe